RoleCall

Software Engineer - Clearance Jobs

DHI Group, Inc.·

awsdockerec2graphqllaravelmysqlphpsdlcsqlterraformtypescriptvue-js

This Is the Place to Be:
Connecting Futures Now! DHI Group, Inc. is the parent company of career marketplaces, Dice and ClearanceJobs. We connect candidates with career advice, resources and ultimately a dream job. At DHI, we’ve built a workplace where great people do meaningful work. This is the place to be, and we want you here with us.

You Belong Here:
Join a mission-driven company that puts its people first. We’re a collaborative, supportive team that lives by our “One Team” value – working together and winning together. Voted as a certified Great Place to Work®, our team members feel their opinions count and are cared for by DHI. 92% of employees say DHI is a Great Place to Work – 35% higher than the average U.S. company.  We’ve built a culture grounded in collaboration, growth, and giving back through volunteering and employee resource groups. Come be part of something worth showing up for!

About the team:

As part of ClearanceJobs, you will utilize your personal and professional knowledge and experience to build and improve features for the ClearanceJobs web application team. This team plays a crucial role in DHI’s product strategy by supporting our HR and job marketplace for recruiters to post jobs, curate leads and connect with our nation’s cleared work force.

About the role:

We're seeking an experienced full stack engineer to work on ClearanceJobs.com, the leading career marketplace for security-cleared professionals. You'll work across a Laravel (PHP) backend, Vue.js frontends, and a MySQL data layer, contributing to multiple interconnected repositories spanning the main web application, internal REST APIs, background job workers, and Terraform-managed infrastructure.

The platform runs on AWS (EC2, RDS, S3, CloudFront, Lambda) and integrates with third-party services for recruiter tooling, identity verification, and analytics. Day to day, you'll ship features that shape how recruiters find and engage cleared candidates — candidate search and matching, workflow automation, job posting tools, messaging, and reporting. You'll own work end-to-end, from scoping with product through implementation, testing, and deployment via our CI/CD pipeline, on a small, senior team that values shipping over debating — we make pragmatic trade-offs, move quickly, and lean toward action rather than relitigating decisions.

Why we’re hiring for this role:

The ClearanceJobs team needs added capacity to bring new features to market quickly without compromising on quality. We're looking for an engineer who is energized by shipping, someone who finds practical paths through hard or unfamiliar changes rather than treating difficulty as a reason to push back. You'll deliver web application improvements, strengthen our tests, contribute to platform work, and implement features efficiently in an established codebase.

In the Short Term, You Will:

Ramp up on Systems and Codebases

Gain familiarity with the product and the infrastructure and codebase which is it composed of.  Develop an understand of how your team’s work fits into the broader picture and the market.

Establish Technical Ownership

Take responsibility for delivering features and changes to systems, provide thoughtful code reviews, and contribute to product and engineering discussions. You will be trusted to make technical decisions and defend them clearly while staying open to feedback.

Collaborate and Align

Work closely with engineers, product management, product design, and other business stakeholders to align on priorities and deliver incremental value. Help improve the team’s planning and execution rhythm.

In the Long Term, You Will

 Drive Technical Excellence

Help assess and evolve our development practices, our codebases and our team processes to develop a well-designed product. Reduce technical debt, lead by example to drive technical excellence, and contribute to shared engineering standards and improvements.

 Mentor and Elevate your Team

 A software engineer at DHI is expected to mento their peers but also accepting mentorship, driving greater outcomes and helping grow the technical abilities of those around you.

Deliver Meaningful Business Impact

 Own the end-to-end delivery of new product features that support our business goals and enhance the user experience. Influence the roadmap by advocating for technical investments and providing insights into the planning process to align with delivering long term value.

 What you bring to the team:

  • A bias toward delivery. You find a way to ship valuable changes even when the work is large, unfamiliar, or touches code you didn't write.
  • Ability to understand the product and ask the right questions to ensure you are aligned with the product vision provided.
  • Able to work with the product owners and product designers to incorporate their requirements into engineering solutions.
  • Able to work within an agile software development framework and adhere to existing team processes.
  • Able to troubleshoot and provide analysis for reports on issues and bugs.
  • Able to disagree well with other engineers, raise concerns clearly, hear the counterargument, and commit to the decision so the team can keep moving.

Required:

  • Proficiency with VueJS, TypeScript, Laravel and PHP 8 or similar frameworks
  • Understanding of state management and component architecture
  • Experience with AWS Lambda, API Gateway, S3, SES, CloudFront, and other core AWS services
  • REST API and GraphQL API development
  • MySQL and SQL query optimization
  • Understanding of database migrations and schema management
  • Terraform for infrastructure as code
  • CI/CD pipelines (AWS CodeBuild/CodePipeline)
  • Docker and containerization fundamentals
  • Git version control and collaborative development workflows
  • Understanding of authentication/authorization (Sessions, OAuth, SSO)
  • Experience with core AWS services (EC2, Lambda, S3, RDS, CloudFront, etc)

 Preferred:

  • Familiarity with Recruitment, HR, or ATS domain concepts (workflows, candidate pipelines, job management)
  • Experience with real-time features and WebSocket patterns
  • Experience with complex form workflows and dialog/modal patterns
  • Background with large dataset rendering (table virtualization, pagination, search-heavy UIs)
  • Experience with application observability and analytics tools.
  • Demonstrated ability to leverage AI tools effectively across the modern SDLC — using coding assistants (Copilot, Cursor, Claude Code, etc.) for implementation, code review, testing, and debugging, with sound judgment about when AI accelerates the work and when it doesn't.

NOTE: This job description is not intended to be an all-inclusive list of the duties and responsibilities of the job described, nor are they intended to be such a listing of the skills and abilities required to do the job. Rather, they are intended only to describe the general nature of the job as of the date this job description was prepared. Management reserves the right to modify this job in order to meet business needs. 

All qualified applicants will receive consideration for employment without regard to age, race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran. 

 

Remote (US-only) pay range: Base salary/pay per year, plus 10% annual bonus at 100% of plan targets tied to company and individual performance. Offer will depend on location and level of job-related knowledge, skills, abilities, and experience.
$100,000$140,000 USD

Benefits

Healthy living - medical, dental, vision, FSA, HSA, disability, life, wellness & fitness programs
Future living - 401(k) match, performance bonuses, education assistance, learning & development
Enjoy living - generous paid time off, parental leave, flexible summer hours, social & giving events

How to apply? 

You can apply below. You'll just need to provide your resume and answer a few questions—it'll only take you a few minutes!


All qualified applicants will receive consideration for employment without regard to age, race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran.

Software Engineer - Clearance Jobs at DHI Group, Inc. · RoleCall